Pfam domain
Pfam family: Sld5 (PF05916.13)
Uniprot AC: Q9BRX5
RecName: DNA replication complex GINS protein PSF3
Begin-End: 66-173
Organism: Homo sapiens
Interaction Mode:   

Sequence:
LELPLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLH
FDSPENADISQSLLQTFIGRFRRIMDSSQNAYNEDTSALVARLDEMER
Structures of the domain Q9BRX5 66-173
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6xtx X-ray 3.29 C 66-173 None


© NPIDB team 2003 - 2021

text