Pfam domain
Pfam family: Ribosomal_S10 (PF00338.24)
Uniprot AC: Q9BYD3
RecName: 39S ribosomal protein L4, mitochondrial
Begin-End: 36-77
Organism: Homo sapiens
Interaction Mode:   

Sequence:
EQVASEGLPEPVLRKVELPVPTHRRPVQAWVESLRGFEQERV
Structures of the domain Q9BYD3 36-77
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ool X-ray 3.06 f 92-150 None
5oom X-ray 3.03 f 92-150 None


© NPIDB team 2003 - 2021

text