Pfam domain
Pfam family: TetR_N (PF00440.25)
Uniprot AC: Q9CHR1
RecName: Transcriptional regulator
Begin-End: 17-59
Organism: Lactococcus lactis subsp. lactis
Interaction Mode:   

Sequence:
VYDACLNEFQTHSFHEAKIMHIVKALDIPRGSFYQYFEDLKDA
Structures of the domain Q9CHR1 17-59
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3vok X-ray 2 A 17-59 None


© NPIDB team 2003 - 2021

text