Pfam domain
Pfam family: Histone (PF00125.26)
Uniprot AC: Q9D2U9
RecName: Histone H2B type 3-A
Begin-End: 31-102
Organism: Mus musculus
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
KRGRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTI
TSREVQTAVRLL
Structures of the domain Q9D2U9 31-102
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xm1 X-ray 3.45 H 34-101  H-Bb H-Mj L-Bb 
5xm1 X-ray 3.45 D 31-101  H-Bb H-Mj S-Bb L-Bb 
2f8n X-ray 2.9 D 1230-1298  H-Bb H-Mj S-Bb L-Bb 
1u35 X-ray 3 H 1427-1498  H-Bb H-Mj S-Bb L-Bb 
1u35 X-ray 3 D 1230-1298  H-Bb H-Mj S-Bb L-Bb 
5b1l X-ray 2.35 D 32-101  H-Bb H-Mj S-Bb L-Bb 
5b1l X-ray 2.35 H 33-101  H-Bb H-Mj S-Bb L-Bb 
5xm0 X-ray 2.87 H 33-101  H-Bb S-Bb L-Bb 
5xm0 X-ray 2.87 D 31-101  H-Bb H-Mj S-Bb L-Bb 
5b1m X-ray 2.34 H 33-101  H-Bb S-Bb L-Bb 
5b1m X-ray 2.34 D 31-101  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2021

text