Pfam domain
Pfam family: z-alpha (PF02295.19)
Uniprot AC: Q9DHS8
RecName: 34L protein
Begin-End: 10-73
Organism: Yaba-like disease virus
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
DAEIFSLVKKEVLSLNTNDYTTAISLSNRLKINKKKINQQLYKLQKEDTVKMVPSNPPKW
FKNY
Structures of the domain Q9DHS8 10-73
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1sfu X-ray 2 A 10-73  H-Bb H-Mj S-Bb L-Bb 
1sfu X-ray 2 B 10-73  H-Bb H-Mj S-Bb 


© NPIDB team 2003 - 2021

text