Pfam domain
Pfam family: RNA_pol_Rpb6 (PF01192.24)
Uniprot AC: Q9EVV4
RecName: DNA-directed RNA polymerase subunit omega
Begin-End: 8-75
Organism: Thermus aquaticus
Interaction Mode:   

Sequence:
KLFGMVDSKYRLTVVVAKRAQQLLRHRFKNTVLEPEERPKMRTLEGLYDDPNAVTWAMKE
LLTGRLFF
Structures of the domain Q9EVV4 8-75
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1l9z X-ray 6.5 E 8-75 None
5tjg X-ray 2.6 E 8-75 None
4xlr X-ray 4.3 K 8-75 None
4xlr X-ray 4.3 E 8-75 None
4xls X-ray 4.01 K 8-75 None
4xls X-ray 4.01 E 8-75 None
4xls X-ray 4.01 K 8-75 None
4xls X-ray 4.01 E 8-75 None
4xlp X-ray 4 K 8-75 None
4xlp X-ray 4 E 8-75 None
4xlq X-ray 4.6 E 8-75 None
4xlq X-ray 4.6 K 8-75 None
4xln X-ray 4 E 8-75 None
4xln X-ray 4 K 8-75 None


© NPIDB team 2003 - 2021

text