Pfam domain
Pfam family: Sigma70_r3 (PF04539.18)
Uniprot AC: Q9EZJ8
RecName: RNA polymerase sigma factor SigA
Begin-End: 281-360
Organism: Thermus aquaticus
Interaction Mode:   

Sequence:
ETINKLSRTARQLQQELGREPSYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETPIGDEK
DSFYGDFIPDENLPSPVEAA
Structures of the domain Q9EZJ8 281-360
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1l9z X-ray 6.5 H 281-363 None
5tjg X-ray 2.6 F 281-360 None
4xlr X-ray 4.3 L 281-360  H-Mj 
4xlr X-ray 4.3 F 281-360  H-Mj 
4xls X-ray 4.01 L 281-360 None
4xls X-ray 4.01 F 281-360  H-Mj 
4xls X-ray 4.01 L 281-360 None
4xls X-ray 4.01 F 281-360  H-Mj 
4xlp X-ray 4 L 281-360 None
4xlp X-ray 4 F 281-360 None
4xlq X-ray 4.6 F 281-360  H-Bb H-Mj 
4xlq X-ray 4.6 L 281-360  H-Mj 
4xln X-ray 4 F 281-360 None
4xln X-ray 4 L 281-360 None


© NPIDB team 2003 - 2021

text