Pfam domain
Pfam family: Sigma70_r4 (PF04545.18)
Uniprot AC: Q9EZJ8
RecName: RNA polymerase sigma factor SigA
Begin-End: 372-425
Organism: Thermus aquaticus
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
ALSKLSEREAMVLKLRKGLIDGREHTLEEVGAYFGVTRERIRQIENKALRKLKY
Structures of the domain Q9EZJ8 372-425
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1ku7 X-ray 2.4 D 372-425 None
1ku7 X-ray 2.4 A 372-425  H-Bb H-Mj L-Bb L-Mj 
1rio X-ray 2.3 H 372-425  H-Bb H-Mj L-Bb L-Mj 
1l9z X-ray 6.5 H 372-425 None
5tjg X-ray 2.6 F 372-425 None
4xlr X-ray 4.3 L 372-425  H-Bb H-Mj L-Bb L-Mj 
4xlr X-ray 4.3 F 372-425  H-Bb H-Mj L-Bb 
4xls X-ray 4.01 L 372-425  H-Bb H-Mj L-Bb L-Mj 
4xls X-ray 4.01 F 372-425  H-Bb H-Mj L-Bb L-Mj 
4xls X-ray 4.01 L 372-425  H-Bb H-Mj L-Bb L-Mj 
4xls X-ray 4.01 F 372-425  H-Bb H-Mj L-Bb L-Mj 
4xlp X-ray 4 L 372-425  H-Bb H-Mj L-Bb L-Mj 
4xlp X-ray 4 F 372-425  H-Bb H-Mj L-Bb L-Mj 
4xlq X-ray 4.6 F 372-425  H-Bb H-Mj L-Bb L-Mj 
4xlq X-ray 4.6 L 372-425  H-Bb H-Mj L-Bb L-Mj 
4xln X-ray 4 F 372-425  H-Bb H-Mj L-Bb L-Mj 
4xln X-ray 4 L 372-425  H-Bb H-Mj L-Bb L-Mj 
3n97 X-ray 3.25 A 374-425  H-Bb H-Mj L-Bb L-Mj 
3n97 X-ray 3.25 D 375-424 None


© NPIDB team 2003 - 2021

text