Pfam domain
Pfam family: z-alpha (PF02295.19)
Uniprot AC: Q9H171
RecName: Z-DNA-binding protein 1
Begin-End: 107-164
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj H-Mn S-Bb L-Bb 

Sequence:
QQREEDIYRFLKDNGPQRALVIAQALGMRTAKDVNRDLYRMKSRHLLDMDEQSKAWTI
Structures of the domain Q9H171 107-164
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3eyi X-ray 1.45 A 105-162  H-Bb H-Mj H-Mn S-Bb 
3eyi X-ray 1.45 B 105-160  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2021

text