Pfam domain
Pfam family: z-alpha (PF02295.19)
Uniprot AC: Q9H171
RecName: Z-DNA-binding protein 1
Begin-End: 97-152
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb 

Sequence:
IPETPGPQFSQQREEDIYRFLKDNGPQRALVIAQALGMRTAKDVNRDLYRMKSRHL
Structures of the domain Q9H171 97-152
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4ka4 X-ray 2.6 B 107-162  H-Bb H-Mj 
4ka4 X-ray 2.6 E 107-162  H-Bb H-Mj S-Bb 
4ka4 X-ray 2.6 D 106-159  H-Bb H-Mj S-Bb 
4ka4 X-ray 2.6 A 105-162  H-Bb H-Mj S-Bb 


© NPIDB team 2003 - 2021

text