Pfam domain
Pfam family: Piwi (PF02171.19)
Uniprot AC: Q9HCK5
RecName: Protein argonaute-4
Begin-End: 509-820
Organism: Homo sapiens
Interaction Mode:   

Sequence:
LIVVILPGKTPVYAEVKRVGDTLLGMATQCVQVKNVVKTSPQTLSNLCLKINAKLGGINN
VLVPHQRPSVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDGHPSRYCATVRVQTSRQ
EISQELLYSQEVIQDLTNMVRELLIQFYKSTRFKPTRIIYYRGGVSEGQMKQVAWPELIA
IRKACISLEEDYRPGITYIVVQKRHHTRLFCADKTERVGKSGNVPAGTTVDSTITHPSEF
DFYLCSHAGIQGTSRPSHYQVLWDDNCFTADELQLLTYQLCHTYVRCTRSVSIPAPAYYA
RLVAFRARYHLV
Structures of the domain Q9HCK5 509-820
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6oon X-ray 1.9 A 509-820 None


© NPIDB team 2003 - 2021

text