Pfam domain
Pfam family: TetR_N (PF00440.25)
Uniprot AC: Q9HUS3
RecName: DesT
Begin-End: 16-63
Organism: Pseudomonas aeruginosa
Interaction Mode:   

Sequence:
LMSAARHLMESGRGFGSLSLREVTRAAGIVPAGFYRHFSDMDQLGLAL
Structures of the domain Q9HUS3 16-63
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3lsp X-ray 2.66 A 16-63 None
3lsp X-ray 2.66 A 16-63 None
3lsr X-ray 2.55 A 16-63 None


© NPIDB team 2003 - 2021

text