Pfam domain
Pfam family: TetR_N (PF00440.25)
Uniprot AC: Q9HZR6
RecName: CifR
Begin-End: 15-61
Organism: Pseudomonas aeruginosa
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
ALQRAMDVFWVRGYEGASLAALTEAMEIRPPSLYAAFGSKEGLFREA
Structures of the domain Q9HZR6 15-61
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6nsn X-ray 2.6 B 15-61  H-Bb H-Mj L-Bb L-Mj 
6nsn X-ray 2.6 A 15-61  H-Bb H-Mj L-Bb L-Mj 
6nsm X-ray 2.8 B 15-61  H-Bb H-Mj L-Bb L-Mj 
6nsm X-ray 2.8 A 15-61  H-Bb H-Mj L-Bb L-Mj 
6nsr X-ray 3 B 19-61  H-Bb H-Mj L-Mj 
6nsr X-ray 3 A 19-61  H-Bb H-Mj L-Bb L-Mj 
6nsr X-ray 3 M 19-61 None


© NPIDB team 2003 - 2021

text