Pfam domain
Pfam family: FtsK_SpoIIIE (PF01580.20)
Uniprot AC: Q9I0M3
RecName: DNA translocase FtsK
Begin-End: 422-635
Organism: Pseudomonas aeruginosa
Interaction Mode:   

Sequence:
RFSEVLSSPEYDEHKSTVPLALGHDIGGRPIITDLAKMPHLLVAGTTGSGKSVGVNAMLL
SILFKSTPSEARLIMIDPKMLELSIYEGIPHLLCPVVTDMKEAANALRWSVAEMERRYRL
MAAMGVRNLAGFNRKVKDAEEAGTPLTDPLFRRESPDDEPPQLSTLPTIVVVVDEFADMM
MIVGKKVEELIARIAQKARAAGIHLILATQRPSV
Structures of the domain Q9I0M3 422-635
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6t8b X-ray 3.65 E 422-635 None
6t8b X-ray 3.65 F 422-635  L-Bb 
6t8b X-ray 3.65 D 422-635 None
6t8b X-ray 3.65 C 422-635  L-Bb 
6t8b X-ray 3.65 B 422-635  L-Bb L-Mj 
6t8b X-ray 3.65 A 422-635  L-Bb 
6t8o X-ray 3.99 F 422-635  L-Bb 
6t8o X-ray 3.99 E 422-635 None
6t8o X-ray 3.99 B 422-635 None
6t8o X-ray 3.99 D 422-635 None
6t8o X-ray 3.99 C 422-635 None
6t8o X-ray 3.99 A 422-635  L-Bb 
6t8g X-ray 4.34 D 422-635 None
6t8g X-ray 4.34 C 422-635 None
6t8g X-ray 4.34 E 422-635 None
6t8g X-ray 4.34 F 422-635  L-Bb 
6t8g X-ray 4.34 A 422-635  L-Bb 


© NPIDB team 2003 - 2021

text