Pfam domain
Pfam family: FtsK_SpoIIIE (PF01580.20)
Uniprot AC: Q9I0M3
RecName: DNA translocase FtsK
Begin-End: 495-552
Organism: Pseudomonas aeruginosa
Interaction Mode:   

Sequence:
IMIDPKMLELSIYEGIPHLLCPVVTDMKEAANALRWSVAEMERRYRLMAAMGVRNLAG
Structures of the domain Q9I0M3 495-552
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6t8g X-ray 4.34 B 562-635 None


© NPIDB team 2003 - 2021

text