Pfam domain
Pfam family: TetR_N (PF00440.25)
Uniprot AC: Q9I1S1
RecName: Probable transcriptional regulator
Begin-End: 12-58
Organism: Pseudomonas aeruginosa
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
LLDTGYRIMAVKGFSGVGLNEILQSAGVPKGSFYHYFKSKEQFGQAL
Structures of the domain Q9I1S1 12-58
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4l62 X-ray 2.9 C 12-58  H-Bb H-Mj L-Bb 
4l62 X-ray 2.9 D 12-58  H-Bb H-Mj L-Bb L-Mj 
4l62 X-ray 2.9 B 12-58  H-Bb H-Mj L-Bb L-Mj 
4l62 X-ray 2.9 A 12-58  H-Bb H-Mj L-Bb 
4l62 X-ray 2.9 H 12-58  H-Bb H-Mj L-Bb L-Mj 
4l62 X-ray 2.9 G 12-58  H-Bb H-Mj L-Bb L-Mj 
4l62 X-ray 2.9 F 12-58  H-Bb H-Mj L-Bb L-Mj 
4l62 X-ray 2.9 E 12-58  H-Bb H-Mj L-Bb 
4l62 X-ray 2.9 L 12-58  H-Bb H-Mj L-Bb L-Mj 
4l62 X-ray 2.9 K 12-58  H-Bb H-Mj L-Bb L-Mj 
4l62 X-ray 2.9 J 12-58  H-Bb H-Mj L-Bb L-Mj 
4l62 X-ray 2.9 I 12-58  H-Bb H-Mj L-Bb 
4l62 X-ray 2.9 M 12-58  H-Bb H-Mj L-Bb 
4l62 X-ray 2.9 N 12-58  H-Bb H-Mj L-Bb L-Mj 
4l62 X-ray 2.9 P 12-58  H-Bb H-Mj L-Bb L-Mj 
4l62 X-ray 2.9 O 12-58  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2021

text