Pfam domain
Pfam family: Pox_A22 (PF04848.15)
Uniprot AC: Q9J546
RecName: Holliday junction resolvase
Begin-End: 1-148
Organism: Fowlpox virus
Interaction Mode:   

Sequence:
MIICSVDIGIKNPAYAIFNYDNTSNTIKLIAIEKSDWTKNWERSVARDLTRYNPDVVILE
KQGFKSPNSKIIYFIKGFFYNSNTKVIVRNPTFKGGSYRNRKKQSIDVFIQKISEYTDYK
NDILNKYTKLDDIADSFNLGLSYMESLL
Structures of the domain Q9J546 1-148
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6p7b X-ray 3.32 C 1-147 None
6p7b X-ray 3.32 A 1-148  L-Bb L-Mj 
6p7b X-ray 3.32 B 1-147  H-Bb H-Mn 
6p7b X-ray 3.32 D 2-146 None


© NPIDB team 2003 - 2021

text