Pfam domain
Pfam family: Peptidase_A6 (PF01829.18)
Uniprot AC: Q9J7Z0
RecName: Capsid protein alpha
Begin-End: 45-361
Organism: Pariacoto virus
Interaction Mode:   

Sequence:
ALVRNPRLTDAGLAFLKCAFAAPDFSVDPGKGIPDNFHGRTLAIKDCNTTSVVFTPNTDT
YIVVAPVPGFAYFRAEVAVGAQPTTFVGVPYPTYATNFGAGSQNGLPAVNNYSKFRYASM
ACGLYPTSNMMQFSGSVQVWRVDLNLSEAVNPAVTAITPAPGVFANFVDKRINGLRGIRP
LAPRDNYSGNFIDGAYTFAFDKSTDFEWCDFVRSLEFSESNVLGAATAMKLLAPGGGTDT
TLTGLGNVNTLVYKISTPTGAVNTAILRTWNCIELQPYTDSALFQFSGVSPPFDPLALEC
YHNLKMRFPVAVSSREN
Structures of the domain Q9J7Z0 45-361
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1f8v X-ray 3 A 45-361 None


© NPIDB team 2003 - 2021

text