Pfam domain
Pfam family: HHH_8 (PF14716.8)
Uniprot AC: Q9JIW4
RecName: DNA-directed DNA/RNA polymerase mu
Begin-End: 153-218
Organism: Mus musculus
Interaction Mode:   

Sequence:
NTLLSEALETLAEAAGFEANEGRLLSFSRAASVLKSLPCPVASLSQLHGLPYFGEHSTRV
IQELLE
Structures of the domain Q9JIW4 153-218
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2ihm X-ray 2.4 B 153-218 None
2ihm X-ray 2.4 A 153-218 None


© NPIDB team 2003 - 2021

text