Pfam domain
Pfam family: DNA_pol_lambd_f (PF10391.11)
Uniprot AC: Q9JIW4
RecName: DNA-directed DNA/RNA polymerase mu
Begin-End: 238-287
Organism: Mus musculus
Interaction Mode:  H-Bb L-Bb 

Sequence:
KLFTQVFGVGVKTANRWYQEGLRTLDELREQPQRLTQQQKAGLQYYQDLS
Structures of the domain Q9JIW4 238-287
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2ihm X-ray 2.4 B 238-287  H-Bb L-Bb 
2ihm X-ray 2.4 A 238-287  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text