Pfam domain
Pfam family: TetR_N (PF00440.25)
Uniprot AC: Q9K8A4
RecName: Transcriptional regulator (TetR/AcrR family)
Begin-End: 12-58
Organism: Bacillus halodurans
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
IIDAAVQVIAEHGYHQAQVSKIAKAAGVADGTIYLYFNNKEDVLISL
Structures of the domain Q9K8A4 12-58
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5gpc X-ray 2.8 D 12-58  H-Bb H-Mj L-Bb L-Mj 
5gpc X-ray 2.8 A 12-58  H-Bb H-Mj L-Bb L-Mj 
5gpc X-ray 2.8 B 12-58  H-Bb H-Mj L-Bb L-Mj 
5gpc X-ray 2.8 C 12-58  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text