Pfam domain
Pfam family: RNase_T (PF00929.26)
Uniprot AC: Q9KV17
RecName: Oligoribonuclease
Begin-End: 9-171
Organism: Vibrio cholerae serotype O1
Interaction Mode:   

Sequence:
IWIDLEMTGLDPEMHKIIEMATIVTDSELNILAEGPVIAIHQPESELAKMDEWCTTTHTA
SGLVARVRQSQVSEEEAIDQTLAFLKQWVPEGKSPICGNSIGQDRRFLYKHMPRLEAYFH
YRYIDVSTIKELTRRWQPEVLKEFSKTGSHLALDDIRESIAEL
Structures of the domain Q9KV17 9-171
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6n6e X-ray 1.58 A 9-171 None
6n6c X-ray 1.62 A 9-171 None
6n6d X-ray 1.53 A 9-171 None
6n6a X-ray 1.5 A 9-171 None
6n6g X-ray 2.02 A 9-171 None
6n6f X-ray 1.74 A 9-171 None
6n6h X-ray 1.76 A 9-171 None


© NPIDB team 2003 - 2021

text