Pfam domain
Pfam family: TetR_N (PF00440.25)
Uniprot AC: Q9KVD2
RecName: Nucleoid occlusion factor SlmA
Begin-End: 13-60
Organism: Vibrio cholerae serotype O1
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
ILQALAEMLESNEGASRITTAKLAKQVGVSEAALYRHFPSKARMFEGL
Structures of the domain Q9KVD2 13-60
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4gct X-ray 2.45 D 13-60  H-Bb H-Mj L-Bb L-Mj 
4gct X-ray 2.45 C 13-60  H-Bb H-Mj L-Bb 
4gct X-ray 2.45 B 13-60  H-Bb H-Mj L-Bb 
4gct X-ray 2.45 A 13-60  H-Bb H-Mj L-Bb L-Mj 
5haw X-ray 1.89 B 13-60 None
5haw X-ray 1.89 A 13-60 None
5haw X-ray 1.89 B 13-60 None
5haw X-ray 1.89 A 13-60 None


© NPIDB team 2003 - 2021

text