Pfam domain
Pfam family: RNA_pol_Rpb1_1 (PF04997.14)
Uniprot AC: Q9KWU6
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 2-495
Organism: Thermus aquaticus
Interaction Mode:   

Sequence:
KKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACG
KYKRQRFEGKVCERCGVEVTRSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSAT
ELEQVLYFNKYIVLDPKGAVLDGVPVEKRQLLTDEEYRELRYGKQETYPLPAGVDALVKD
GEEVVKGQELAPGVVSRMDGVALYRFPRRVRVDYLRKERAALRIPLSAWVEKEAYRPGEV
LAELSEPYLFRAEESGVVELKDLAEGHLIYLRQEEEVVARYFLPAGMTPLVVEGEIVEVG
QPLAEGKGLLRLPRHMTAKEVEAEEEGDSVHLTLFLEWTEPKDYKVAPHMNVIVPEGAKV
QAGEKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARVYPFEDDVEVTTGDRVAPGDVL
ADGGKVKSEIYGRVEVDLVRNVVRVVESYDIDARMGAEAIQELLKELDLEKLERELLEEM
KHPSRARRAKARKR
Structures of the domain Q9KWU6 2-495
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4xlr X-ray 4.3 J 2-618 None
4xls X-ray 4.01 J 2-618  L-Bb 
4xls X-ray 4.01 J 2-618  L-Bb 
4xlp X-ray 4 J 2-618  L-Bb 
4xlq X-ray 4.6 J 2-618  L-Bb 
4xln X-ray 4 J 2-618 None


© NPIDB team 2003 - 2021

text