Pfam domain
Pfam family: DNA_pol_B_palm (PF14792.8)
Uniprot AC: Q9NP87
RecName: DNA-directed DNA/RNA polymerase mu
Begin-End: 290-387
Organism: Homo sapiens
Interaction Mode:   

Sequence:
VLRSDVDALQQVVEEAVGQALPGATVTLTGGFRRGKLQGHDVDFLITHPKEGQEAGLLPR
VMCRLQDQGLILYHQHQHSCCESPTRLAQQSHMDAFER
Structures of the domain Q9NP87 290-387
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5tyv X-ray 1.93 A 290-424 None
4m04 X-ray 1.9 A 290-424 None
6ipf X-ray 1.77 A 290-424 None
6ak8 X-ray 1.74 A 290-424 None
6p1s X-ray 1.75 A 290-424 None
5vzd X-ray 1.6 A 290-424 None
5tyg X-ray 1.73 A 290-424 None
6p1m X-ray 1.65 A 290-424 None
5vzi X-ray 1.5 A 290-424 None
6p1o X-ray 1.65 A 290-424 None
5vze X-ray 1.51 A 290-424 None
6p1t X-ray 1.7 A 290-424 None
5tyf X-ray 1.97 A 290-424 None
5txz X-ray 1.65 A 290-424 None
5txx X-ray 1.95 A 290-424 None
5tye X-ray 2.05 A 290-424 None
5twp X-ray 2 A 290-424 None
4lzg X-ray 1.6 A 290-424 None
5vzc X-ray 1.55 A 290-424 None
5vz7 X-ray 1.55 A 290-424 None
6akh X-ray 1.75 A 290-424 None
5vz9 X-ray 1.65 A 290-424 None
4yd1 X-ray 1.75 A 290-424 None
4m0a X-ray 1.85 A 290-424 None
5twq X-ray 1.8 A 290-424 None
6p1p X-ray 1.75 A 290-424 None
5tyz X-ray 1.98 A 290-424 None
5tyu X-ray 2.05 A 290-424 None
6ipe X-ray 1.7 A 290-424 None
5tyc X-ray 2.1 A 290-424 None
5tyy X-ray 1.93 A 290-424 None
6p1v X-ray 1.95 A 290-424 None
5tyd X-ray 1.9 A 290-424 None
6p1w X-ray 1.75 A 290-424 None
5twr X-ray 1.9 A 290-424 None
6ipd X-ray 1.7 A 290-424 None
5vz8 X-ray 1.6 A 290-424 None
6p1u X-ray 1.75 A 290-424 None
5tyx X-ray 1.95 A 290-424 None
5vzg X-ray 1.85 A 290-424 None
5vzh X-ray 1.95 A 290-424 None
4yd2 X-ray 2.47 A 290-423 None
5vzb X-ray 1.5 A 290-424 None
6ipg X-ray 1.62 A 290-424 None
6p1r X-ray 1.7 A 290-424 None
5tws X-ray 1.85 A 290-424 None
4ycx X-ray 2.1 A 290-424 None
5vzf X-ray 1.65 A 290-424 None
5tyw X-ray 1.88 A 290-424 None
6ak9 X-ray 1.91 A 290-424 None
5vza X-ray 1.5 A 290-424 None
6p1n X-ray 1.6 A 290-424 None
6p1q X-ray 1.9 A 290-424 None
5tyb X-ray 1.85 A 290-424 None
6wie X-ray 1.5 A 290-424 None
6wic X-ray 1.55 A 290-424 None
6wid X-ray 1.5 A 290-424 None


© NPIDB team 2003 - 2021

text