Pfam domain
Pfam family: DEAD (PF00270.31)
Uniprot AC: Q9NR30
RecName: Nucleolar RNA helicase 2
Begin-End: 210-385
Organism: Homo sapiens
Interaction Mode:   

Sequence:
FPIQAKTFHHVYSGKDLIAQARTGTGKTFSFAIPLIEKLHGELQDRKRGRAPQVLVLAPT
RELANQVSKDFSDITKKLSVACFYGGTPYGGQFERMRNGIDILVGTPGRIKDHIQNGKLD
LTKLKHVVLDEVDQMLDMGFADQVEEILSVAYKKDSEDNPQTLLFSATCPHWVFNV
Structures of the domain Q9NR30 210-385
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6l5n X-ray 2.24 A 210-387 None
6l5n X-ray 2.24 B 210-387 None


© NPIDB team 2003 - 2021

text