Pfam domain
Pfam family: Myb_DNA-bind_6 (PF13921.8)
Uniprot AC: Q9P6H9
RecName: DNA-binding protein reb1
Begin-End: 308-369
Organism: Schizosaccharomyces pombe
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
NPFEDRCVWSKEEDEELRKNVVEHGKCWTKIGRKMARMPNDCRDRWRDVVRFGDKLKRNA
WS
Structures of the domain Q9P6H9 308-369
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5eyb X-ray 2.7 B 316-377  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2021

text