Pfam domain
Pfam family: z-alpha (PF02295.19)
Uniprot AC: Q9QY24
RecName: Z-DNA-binding protein 1
Begin-End: 13-69
Organism: Mus musculus
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
NLEQKILQVLSDDGGPVKIGQLVKKCQVPKKTLNQVLYRLKKEDRVSSPEPATWSIG
Structures of the domain Q9QY24 13-69
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2heo X-ray 1.7 D 112-168  H-Bb H-Mj S-Bb L-Bb 
2heo X-ray 1.7 A 112-169  H-Bb H-Mj S-Bb L-Bb 
1j75 X-ray 1.85 A 113-169 None


© NPIDB team 2003 - 2021

text