Pfam domain
Pfam family: HLH (PF00010.28)
Uniprot AC: Q9QZQ0
RecName: Neuronal PAS domain-containing protein 3
Begin-End: 57-109
Organism: Mus musculus
Interaction Mode:   

Sequence:
ALRKEKSRDAARSRRGKENFEFYELAKLLPLPAAITSQLDKASIIRLTISYLK
Structures of the domain Q9QZQ0 57-109
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5sy7 X-ray 4.2 B 59-111  H-Bb H-Mj 


© NPIDB team 2003 - 2021

text