Pfam domain
Pfam family: RNase_T (PF00929.26)
Uniprot AC: Q9R1A9
RecName: Three prime repair exonuclease 2
Begin-End: 11-201
Organism: Mus musculus
Interaction Mode:  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 

Sequence:
VFLDLEATGLPNMDPEIAEISLFAVHRSSLENPERDDSGSLVLPRVLDKLTLCMCPERPF
TAKASEITGLSSESLMHCGKAGFNGAVVRTLQGFLSRQEGPICLVAHNGFDYDFPLLCTE
LQRLGAHLPQDTVCLDTLPALRGLDRAHSHGTRAQGRKSYSLASLFHRYFQAEPSAAHSA
EGDVHTLLLIF
Structures of the domain Q9R1A9 11-201
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6a4b X-ray 2.7 B 11-201 None
6a4b X-ray 2.7 C 11-201 None
6a4b X-ray 2.7 D 11-201 None
6a4b X-ray 2.7 E 11-201 None
6a47 X-ray 1.9 A 11-201  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text