Pfam domain
Pfam family: Topoisom_I (PF01028.22)
Uniprot AC: Q9RWH8
RecName: Type I topoisomerase, putative
Begin-End: 81-289
Organism: Deinococcus radiodurans
Interaction Mode:   

Sequence:
PDFVQAGALKKWQRLTRFAGALPTLKVATTADLRASGLPPRKVMALMTRLLHVARFRVGS
DIYARQHKTYGLSTLRQRHVVVDGNTVTFRFKGKHGVSQHKATSDRTLAANMQKLLDLPG
PWLFQTVDAGGGERRRIHSTELNAYLREVIGPFTAKDFRTWGGTLLAAEYLAQQGTESSE
RQAKKVLVDCVKFVADDLGNTPAVTRGSY
Structures of the domain Q9RWH8 81-289
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3m4a X-ray 1.65 A 82-289 None


© NPIDB team 2003 - 2021

text