Pfam domain
Pfam family: HTH_18 (PF12833.9)
Uniprot AC: Q9S166
RecName: AdpA
Begin-End: 253-332
Organism: Streptomyces griseus
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
LAARAYMSRRTFDRRFRSLTGSAPLQWLITQRVLQAQRLLETSDYSVDEVAGRCGFRSPV
ALRGHFRRQLGSSPAAYRAA
Structures of the domain Q9S166 253-332
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3w6v X-ray 2.95 A 253-332  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2021

text