Pfam domain
Pfam family: Myb_DNA-binding (PF00249.33)
Uniprot AC: Q9SEI0
RecName: Transcription factor WER
Begin-End: 18-65
Organism: Arabidopsis thaliana
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
KGLWTVEEDKILMDYVKAHGKGHWNRIAKKTGLKRCGKSCRLRWMNYL
Structures of the domain Q9SEI0 18-65
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kks X-ray 2.15 A 18-65  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2021

text