Pfam domain
Pfam family: DNA_pol_lambd_f (PF10391.11)
Uniprot AC: Q9U6N3
RecName: DNA polymerase beta
Begin-End: 97-150
Organism: Leishmania infantum
Interaction Mode:  H-Bb H-Mn L-Bb 

Sequence:
QELTQVHGFGPRAAAALFDREGIFTVDELLQKADSIPSLTDQQRVGIKYFYDIN
Structures of the domain Q9U6N3 97-150
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4p4m X-ray 1.92 A 97-150 None
4p4o X-ray 2.3 A 97-150  H-Bb H-Mn L-Bb 
4p4p X-ray 2.3 A 97-150  H-Bb H-Mn L-Bb 


© NPIDB team 2003 - 2021

text