Pfam domain
Pfam family: IMS (PF00817.22)
Uniprot AC: Q9UBZ9
RecName: DNA repair protein REV1
Begin-End: 422-622
Organism: Homo sapiens
Interaction Mode:  H-Bb 

Sequence:
VDMDCFFVSVGIRNRPDLKGKPVAVTSNRGTGRAPLRPGANPQLEWQYYQNKILKGKAAD
IPDSSLWENPDSAQANGIDSVLSRAEIASCSYEARQLGIKNGMFFGHAKQLCPNLQAVPY
DFHAYKEVAQTLYETLASYTHNIEAVSCDEALVDITEILAETKLTPDEFANAVRMEIKDQ
TKCAASVGIGSNILLARMATR
Structures of the domain Q9UBZ9 422-622
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3gqc X-ray 2.5 D 422-622 None
3gqc X-ray 2.5 C 422-622  H-Bb 
3gqc X-ray 2.5 B 422-622  H-Bb 
3gqc X-ray 2.5 A 422-622  H-Bb 


© NPIDB team 2003 - 2021

text