Pfam domain
Pfam family: WGR (PF05406.17)
Uniprot AC: Q9UGN5
RecName: Poly [ADP-ribose] polymerase 2
Begin-End: 115-195
Organism: Homo sapiens
Interaction Mode:   

Sequence:
YDVMLNQTNLQFNNNKYYLIQLLEDDAQRNFSVWMRWGRVGKMGQHSLVACSGNLNKAKE
IFQKKFLDKTKNNWEDREKFE
Structures of the domain Q9UGN5 115-195
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6x0n X-ray 10 R 102-182 None
6x0n X-ray 10 P 102-182 None
6f5f X-ray 2.98 A 115-195 None
6f5f X-ray 2.98 D 115-195 None
6f5f X-ray 2.98 B 115-195 None
6f1k X-ray 2.2 A 115-195 None
6f5b X-ray 2.8 A 115-195  H-Bb S-Bb S-Mn L-Bb 
6f5b X-ray 2.8 B 115-195  H-Bb S-Bb S-Mn L-Bb 
6x0l X-ray 3.9 P 102-182 None
6x0l X-ray 3.9 R 102-182 None
6x0m X-ray 6.3 P 104-184 None
6x0m X-ray 6.3 p 102-182 None
6usj X-ray 10.5 U 102-182 None
6usj X-ray 10.5 V 102-182 None


© NPIDB team 2003 - 2021

text