Pfam domain
Pfam family: DNA_pol_lambd_f (PF10391.11)
Uniprot AC: Q9UGP5
RecName: DNA polymerase lambda
Begin-End: 336-384
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mn L-Bb 

Sequence:
ELFSNIWGAGTKTAQMWYQQGFRSLEDIRSQASLTTQQAIGLKHYSDFL
Structures of the domain Q9UGP5 336-384
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2bcs X-ray 2.2 A 336-384  H-Bb H-Mn L-Bb 
2bcq X-ray 1.65 A 336-384  H-Bb H-Mn L-Bb 
1xsn X-ray 1.95 A 336-384  H-Bb L-Bb 
3hx0 X-ray 3 A 336-384  H-Bb L-Bb 
3hx0 X-ray 3 K 336-384  H-Bb L-Bb 
3hx0 X-ray 3 F 336-384  H-Bb L-Bb 
3hx0 X-ray 3 P 336-384  H-Bb L-Bb 
5ca7 X-ray 2.52 A 336-384 None
5ca7 X-ray 2.52 B 336-384  H-Bb L-Bb 
2bcu X-ray 2.2 A 336-384  H-Bb H-Mn L-Bb 
2pfn X-ray 1.9 A 336-384  H-Bb H-Mn L-Bb 
2bcv X-ray 2 A 336-384 None
4xa5 X-ray 1.9 A 336-384  H-Bb H-Mn L-Bb 
2bcr X-ray 1.75 A 336-384  H-Bb H-Mn L-Bb 
4x5v X-ray 2.15 A 336-384  H-Bb H-Mn L-Bb 
1rzt X-ray 2.1 M 336-384 None
1rzt X-ray 2.1 I 336-384 None
1rzt X-ray 2.1 E 336-384 None
1rzt X-ray 2.1 A 336-384 None
3hw8 X-ray 1.95 A 336-384  H-Bb H-Mn L-Bb 
3pmn X-ray 2.2 A 336-384  H-Bb L-Bb 
3pnc X-ray 2 A 336-384  H-Bb L-Bb 
1xsp X-ray 2.2 A 336-384  H-Bb H-Mn L-Bb 
4fo6 X-ray 2.01 A 336-384 None
3uq0 X-ray 2.14 A 336-384  H-Bb L-Bb 
3uq2 X-ray 2.25 A 336-384 None
3upq X-ray 1.95 A 336-384  H-Bb H-Mn L-Bb 
4xrh X-ray 3 A 336-384 None
4xrh X-ray 3 B 336-384  H-Bb L-Bb 
2pfp X-ray 2.1 A 336-384  H-Bb H-Mn L-Bb 
4xq8 X-ray 2.8 A 336-384 None
4xq8 X-ray 2.8 B 336-384  H-Bb L-Bb 
4xus X-ray 2.4 A 336-384 None
4k4g X-ray 2.15 M 336-384  H-Bb L-Bb 
4k4g X-ray 2.15 A 336-384  H-Bb L-Bb 
4k4g X-ray 2.15 E 336-384  H-Bb L-Bb 
4k4g X-ray 2.15 I 336-384 None
5chg X-ray 2.9 B 336-384 None
5chg X-ray 2.9 A 336-384  H-Bb L-Bb 
5ddm X-ray 2.8 A 336-384 None
5ddm X-ray 2.8 B 336-384  H-Bb L-Bb 
4k4i X-ray 2.25 M 336-384  H-Bb L-Bb 
4k4i X-ray 2.25 A 336-384  H-Bb L-Bb 
4k4i X-ray 2.25 E 336-384  H-Bb L-Bb 
4k4i X-ray 2.25 I 336-384 None
5iik X-ray 1.98 A 336-384  H-Bb L-Bb 
5iil X-ray 1.96 A 336-384  H-Bb H-Mn L-Bb 
5iim X-ray 1.94 A 336-384  H-Bb H-Mn L-Bb 
5iin X-ray 2.15 A 336-384  H-Bb H-Mn L-Bb 
5iio X-ray 2.08 M 336-384  H-Bb L-Bb 
5iio X-ray 2.08 I 336-384  H-Bb L-Bb 
5iio X-ray 2.08 E 336-384  H-Bb L-Bb 
5iio X-ray 2.08 A 336-384  H-Bb L-Bb 
5cj7 X-ray 2.9 B 336-384 None
5cj7 X-ray 2.9 A 336-384  H-Bb L-Bb 
5cp2 X-ray 2.36 B 336-384  H-Bb L-Bb 
5cp2 X-ray 2.36 A 336-384 None
5cr0 X-ray 2.75 B 336-384 None
5cr0 X-ray 2.75 A 336-384  H-Bb L-Bb 
5cwr X-ray 2.5 B 336-384  H-Bb L-Bb 
5cwr X-ray 2.5 A 336-384  H-Bb H-Mn L-Bb 
5iij X-ray 1.72 A 336-384  H-Bb H-Mn L-Bb 
1xsl X-ray 2.3 M 336-384  H-Bb L-Bb 
1xsl X-ray 2.3 I 336-384  H-Bb L-Bb 
1xsl X-ray 2.3 E 336-384  H-Bb L-Bb 
1xsl X-ray 2.3 A 336-384  H-Bb L-Bb 
5iii X-ray 1.8 A 336-384  H-Bb L-Bb 
3mgi X-ray 2.6 A 336-384  H-Bb L-Bb 
3mda X-ray 2.03 A 336-384  H-Bb L-Bb 
3mdc X-ray 2 A 336-384  H-Bb H-Mn L-Bb 
3c5f X-ray 2.25 A 336-384  H-Bb L-Bb 
3c5f X-ray 2.25 B 336-384  H-Bb L-Bb 
3c5g X-ray 2.2 A 336-384  H-Bb L-Bb 
3c5g X-ray 2.2 B 336-384  H-Bb H-Mn L-Bb 
2pfo X-ray 2 A 336-384  H-Bb H-Mn L-Bb 
2pfq X-ray 2.1 A 336-384  H-Bb L-Bb 
3mgh X-ray 2.4 C 336-384  H-Bb L-Bb 
3mgh X-ray 2.4 A 336-384  H-Bb L-Bb 
3hwt X-ray 1.95 A 336-384  H-Bb H-Mn L-Bb 
2gws X-ray 2.4 M 336-384  H-Bb L-Bb 
2gws X-ray 2.4 I 336-384  H-Bb L-Bb 
2gws X-ray 2.4 E 336-384  H-Bb L-Bb 
2gws X-ray 2.4 A 336-384  H-Bb L-Bb 
3pml X-ray 2.6 A 336-384  H-Bb L-Bb 
3pml X-ray 2.6 B 336-384  H-Bb L-Bb 
4k4h X-ray 2.1 A 336-384  H-Bb L-Bb 
4k4h X-ray 2.1 E 336-384  H-Bb L-Bb 
4k4h X-ray 2.1 I 336-384 None
4k4h X-ray 2.1 M 336-384  H-Bb L-Bb 
5dkw X-ray 2.69 A 336-384  H-Bb L-Bb 
5dkw X-ray 2.69 B 336-384  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text