Pfam domain
Pfam family: Myb_DNA-binding (PF00249.33)
Uniprot AC: Q9UKL0
RecName: REST corepressor 1
Begin-End: 384-428
Organism: Homo sapiens
Interaction Mode:   

Sequence:
ARWTTEEQLLAVQAIRKYGRDFQAISDVIGNKSVVQVKNFFVNYR
Structures of the domain Q9UKL0 384-428
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4xbf X-ray 2.8 B 381-425 None
6vyp X-ray 4.99 N 381-425 None
6vyp X-ray 4.99 L 381-425 None
6vyp X-ray 4.99 n 381-425 None
6vyp X-ray 4.99 l 381-425 None


© NPIDB team 2003 - 2021

text