Pfam domain
Pfam family: SNF2-rel_dom (PF00176.25)
Uniprot AC: Q9ULG1
RecName: Chromatin-remodeling ATPase INO80
Begin-End: 521-822
Organism: Homo sapiens
Interaction Mode:   

Sequence:
YQLKGMNWLANLYEQGINGILADEMGLGKTVQSIALLAHLAERENIWGPFLIISPASTLN
NWHQEFTRFVPKFKVLPYWGNPHDRKVIRRFWSQKTLYTQDAPFHVVITSYQLVVQDVKY
FQRVKWQYMVLDEAQALKSSSSVRWKILLQFQCRNRLLLTGTPIQNTMAELWALLHFIMP
TLFDSHEEFNEWFSKDIESHAENKSAIDENQLSRLHMILKPFMLRRIKKDVENELSDKIE
ILMYCQLTSRQKLLYQALKNKISIEDLLQSSMGSTQQAQNTTSSLMNLVMQFRKVCNHPE
LF
Structures of the domain Q9ULG1 521-822
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6hts X-ray 4.8 G 521-829 None


© NPIDB team 2003 - 2021

text