Pfam domain
Pfam family: Cdd1 (PF11731.10)
Uniprot AC: Q9UNA4
RecName: DNA polymerase iota
Begin-End: 258-304
Organism: Homo sapiens
Interaction Mode:  H-Bb L-Bb 

Sequence:
LNHIKEIPGIGYKTAKCLEALGINSVRDLQTFSPKILEKELGISVAQ
Structures of the domain Q9UNA4 258-304
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3h4d X-ray 2.2 A 232-278  H-Bb L-Bb 
1t3n X-ray 2.3 B 652-698  H-Bb 
1t3n X-ray 2.3 A 232-278  H-Bb L-Bb 
3h4b X-ray 2.85 A 232-278  H-Bb L-Bb 
2alz X-ray 2.5 A 232-278  H-Bb L-Bb 
1zet X-ray 2.3 A 232-278 None
3h40 X-ray 2.3 A 232-278  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text