Pfam domain
Pfam family: DEAD (PF00270.31)
Uniprot AC: Q9UPY3
RecName: Endoribonuclease Dicer
Begin-End: 2-167
Organism: Homo sapiens
Interaction Mode:   

Sequence:
KSPALQPLSMAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNTI
VCLNTGSGKTFIAVLLTKELSYQIRGDFSRNGKRTVFLVNSANQVAQQVSAVRTHSDLKV
GEYSNLEVNASWTKERWNQEFTKHQVLIMTCYVALNVLKNGYLSLS
Structures of the domain Q9UPY3 2-167
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5zam X-ray 5.7 A 45-210 None
5zal X-ray 4.7 A 45-210 None


© NPIDB team 2003 - 2021

text