Pfam domain
Pfam family: XPG_I (PF00867.20)
Uniprot AC: Q9UQ84
RecName: Exonuclease 1
Begin-End: 141-225
Organism: Homo sapiens
Interaction Mode:  H-Bb L-Bb 

Sequence:
GVDCLVAPYEADAQLAYLNKAGIVQAIITEDSDLLAFGCKKVILKMDQFGNGLEIDQARL
GMCRQLGDVFTEEKFRYMCILSGCD
Structures of the domain Q9UQ84 141-225
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5v04 X-ray 2.65 Z 141-225 None
5v0a X-ray 2.38 Z 141-225  L-Bb 
5v0e X-ray 2.74 Z 141-225 None
3qe9 X-ray 2.51 Z 141-225  L-Bb 
3qe9 X-ray 2.51 Y 141-225  L-Bb 
3qea X-ray 3.1 Z 141-225 None
3qeb X-ray 3 Z 141-225 None
5v08 X-ray 2.81 Z 141-225 None
5v0c X-ray 2.58 Z 141-225 None
5v05 X-ray 2.9 Z 141-225 None
5v0d X-ray 2.63 Z 141-225  L-Bb 
5v09 X-ray 2.75 Z 141-225  L-Bb 
5v0b X-ray 2.63 Z 141-225  H-Bb L-Bb 
5uzv X-ray 2.45 Z 141-225  L-Bb 
5v07 X-ray 2.15 Z 141-225  L-Bb 
5v06 X-ray 2.75 Z 141-225 None


© NPIDB team 2003 - 2021

text