Pfam domain
Pfam family: S1 (PF00575.25)
Uniprot AC: Q9UXC4
RecName: Exosome complex component Rrp4
Begin-End: 64-139
Organism: Saccharolobus solfataricus
Interaction Mode:   

Sequence:
EGSFYYPKINDIVIGLVEDVEIYGWVVDIKAPYKAYLPASNLLGRSINVGEDLRRYLDVG
DYVIARIENFDRSIDP
Structures of the domain Q9UXC4 64-139
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2jea X-ray 2.33 I 69-144 None
4ba2 X-ray 2.5 I 69-144 None


© NPIDB team 2003 - 2021

text