Pfam domain
Pfam family: MCM_OB (PF17207.5)
Uniprot AC: Q9UXG1
RecName: Minichromosome maintenance protein MCM
Begin-End: 108-241
Organism: Saccharolobus solfataricus
Interaction Mode:   

Sequence:
ELRKIRSTDIGKLITIDGILVKVTPVKERIYKATYKHIHPDCMQEFEWPEDEEMPEVLEM
PTICPKCGKPGQFRLIPEKTKLIDWQKAVIQERPEEVPSGQLPRQLEIILEDDLVDSARP
GDRVKVTGILDIKQ
Structures of the domain Q9UXG1 108-241
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6mii X-ray 3.15 D 108-241 None
6mii X-ray 3.15 F 108-241 None
6mii X-ray 3.15 E 108-241 None
6mii X-ray 3.15 B 108-241 None
6mii X-ray 3.15 C 108-241 None
6mii X-ray 3.15 A 108-241 None


© NPIDB team 2003 - 2021

text