Pfam domain
Pfam family: MCM_N (PF14551.8)
Uniprot AC: Q9UXG1
RecName: Minichromosome maintenance protein MCM
Begin-End: 11-102
Organism: Saccharolobus solfataricus
Interaction Mode:   

Sequence:
RDVFIEFLTTFKGNNNQNKYIERINELVAYRKKSLIIEFSDVLSFNENLAYEIINNTKII
LPILEGALYDHILQLDPTYQRDIEKVHVRIVG
Structures of the domain Q9UXG1 11-102
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6mii X-ray 3.15 A 11-102 None
6mii X-ray 3.15 F 11-102 None
6mii X-ray 3.15 E 11-102 None
6mii X-ray 3.15 D 11-102 None
6mii X-ray 3.15 B 11-102 None
6mii X-ray 3.15 C 11-102 None


© NPIDB team 2003 - 2021

text