Pfam domain
Pfam family: MCM (PF00493.25)
Uniprot AC: Q9UXG1
RecName: Minichromosome maintenance protein MCM
Begin-End: 278-499
Organism: Saccharolobus solfataricus
Interaction Mode:   

Sequence:
DEKKIKDLAKDPWIRDRIISSIAPSIYGHWELKEALALALFGGVPKVLEDTRIRGDIHIL
IIGDPGTAKSQMLQFISRVAPRAVYTTGKGSTAAGLTAAVVREKGTGEYYLEAGALVLAD
GGIAVIDEIDKMRDEDRVAIHEAMEQQTVSIAKAGIVAKLNARAAVIAAGNPKFGRYISE
RPVSDNINLPPTILSRFDLIFILKDQPGEQDRELANYILDVH
Structures of the domain Q9UXG1 278-499
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6mii X-ray 3.15 F 278-499 None
6mii X-ray 3.15 E 278-499 None
6mii X-ray 3.15 D 278-499 None
6mii X-ray 3.15 B 278-499 None
6mii X-ray 3.15 C 278-499 None
6mii X-ray 3.15 A 278-499 None


© NPIDB team 2003 - 2021

text