Pfam domain
Pfam family: MCM_lid (PF17855.3)
Uniprot AC: Q9UXG1
RecName: Minichromosome maintenance protein MCM
Begin-End: 511-597
Organism: Saccharolobus solfataricus
Interaction Mode:   

Sequence:
DTLRKYIAYARKYVTPKITSEAKNLITDFFVEMRKKSSETPDSPILITPRQLEALIRISE
AYAKMALKAEVTREDAERAINIMRLFL
Structures of the domain Q9UXG1 511-597
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6mii X-ray 3.15 F 511-597 None
6mii X-ray 3.15 E 511-597 None
6mii X-ray 3.15 D 511-597 None
6mii X-ray 3.15 C 511-597 None
6mii X-ray 3.15 A 511-597 None
6mii X-ray 3.15 B 511-597 None


© NPIDB team 2003 - 2021

text