Pfam domain
Pfam family: Ribosomal_S10 (PF00338.24)
Uniprot AC: Q9V0V6
RecName: 30S ribosomal protein S10
Begin-End: 5-99
Organism: Pyrococcus abyssi
Interaction Mode:   

Sequence:
RIKLASTNVRSLEEVANQIKQIAERTGVRMSGPIPLPTKRIRIVTRKSPDGEGSATFDRW
ELRIHKRLIDIEADERAMRQIMRIRVPEDVTIEIE
Structures of the domain Q9V0V6 5-99
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6sw9 X-ray 4.2 L 5-99 None
6swc X-ray 3.3 L 5-99 None
6swe X-ray 3.1 L 5-99 None


© NPIDB team 2003 - 2021

text