Pfam domain
Pfam family: Ribosomal_S9 (PF00380.21)
Uniprot AC: Q9V195
RecName: 30S ribosomal protein S9
Begin-End: 8-135
Organism: Pyrococcus abyssi
Interaction Mode:   

Sequence:
GKRKTAIARAVIREGKGRVRINGKPVELVEPEIARFTILEPLILAGEEIWNSVDIDVKVQ
GGGFMGQAEAARIAIARALVEWTGDMNLKEKFIKYDRTMLVGDPRRTEPHKPNRSTKGPR
AKRQKSYR
Structures of the domain Q9V195 8-135
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6sw9 X-ray 4.2 K 8-135 None
6swc X-ray 3.3 K 8-135 None
6swe X-ray 3.1 K 8-135 None


© NPIDB team 2003 - 2021

text