Pfam domain
Pfam family: Ribosomal_S8 (PF00410.21)
Uniprot AC: Q9V1V0
RecName: 30S ribosomal protein S8
Begin-End: 5-130
Organism: Pyrococcus abyssi
Interaction Mode:   

Sequence:
DPLANALSHITNSERVGKREVYIKPASKLIGEVLRVMQKYGYIGEFEFIDDGRAGVYRVQ
LLGKINKAGAIKPRFPVKARDYERWEKRFLPAFEFGILIVSTSQGVMSHKEAREKGIGGR
LIAYVY
Structures of the domain Q9V1V0 5-130
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6sw9 X-ray 4.2 I 5-130 None
6swd X-ray 3.2 I 5-130 None
6swc X-ray 3.3 I 5-130 None


© NPIDB team 2003 - 2021

text